Thymosin Beta-4 (TB500) 2mg
Product Overview
Thymosin Beta-4 (commonly referred to as TB500 in its synthetic form) is a peptide of significant interest within laboratory research focused on cellular repair, tissue regeneration, and actin regulation. TB500 is the synthetic analogue of the naturally occurring peptide Thymosin Beta-4, which is present in nearly all human and animal cells.
The 2mg format provides researchers with a lower-quantity option while maintaining the same molecular structure and research applicability as larger vial sizes.
Understanding Thymosin Beta-4 (TB500)
TB500 is a 43-amino-acid peptide involved in the regulation of actin, a protein essential for cell structure, movement, and division. Actin plays a fundamental role in wound repair, muscle tissue maintenance, and cellular signalling, making TB500 a widely studied compound in experimental research settings.
Naturally occurring Thymosin Beta-4 is found throughout the body, including muscle tissue, blood cells, and areas undergoing tissue repair. The synthetic TB500 peptide enables controlled investigation of these biological processes.
Mechanism of Action (Research Context)
Within laboratory models, TB500 is associated with:
-
Regulation of actin polymerisation
-
Support of cell migration and differentiation
-
Involvement in angiogenesis (new blood vessel formation)
-
Modulation of inflammatory signalling pathways
These mechanisms underpin ongoing research into cellular repair, regeneration, and inflammation-related pathways.
Areas of Research Interest
Research involving TB500 commonly focuses on:
-
Tissue repair and regeneration mechanisms
-
Muscle and connective tissue research
-
Inflammatory response modulation
-
Cellular migration and proliferation
-
Angiogenesis-related studies
-
Hair follicle biology research
All applications remain strictly experimental and confined to laboratory research environments.
Conclusion
Thymosin Beta-4 (TB500) is a versatile and extensively researched peptide within cellular and molecular biology. Its role in actin regulation and tissue repair pathways makes it a valuable research tool for studying fundamental biological processes. The 2mg presentation offers flexibility for controlled experimental use while maintaining the same research integrity as larger formats.
Technical Details
-
Synonyms: Thymosin Beta-4, Tβ4, Beta-Thymosin 4, Timbetasin
-
Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
-
IUPAC Condensed: Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
-
Molecular Weight: ~4,963 g/mol
-
CAS Number: 77591-33-4
-
PubChem CID: 16132341
-
Reference: PubChem Link
Storage & Stability
-
Stability: Store lyophilised peptide at -20 °C.
-
Aliquot after reconstitution to avoid repeated freeze–thaw cycles.
-
Reconstituted peptide may be stored at 4 °C for a limited period.
-
Lyophilised material remains stable until expiry when stored at -20 °C.
-
Source: Biosynthesis
-
Reconstitution: Reconstitute with bacteriostatic water.
Usage Disclaimer
This product is supplied for laboratory research purposes only.
Thymosin Beta-4 (TB500) sold by Pure Peptides UK is intended exclusively for scientific research and educational use. Purchase and use are restricted to licensed researchers.










