Premium TB-500 2 mg (Thymosin Beta-4 Acetate)
Exploring the Potential of TB-500: A Versatile Research Peptide
In the field of biochemical and performance research, scientists continue to explore compounds that may support cellular recovery and regeneration. One such peptide attracting increasing attention is TB-500, the synthetic version of the naturally occurring Thymosin Beta-4 found in nearly all human and animal cells.
TB-500 plays a crucial role in the regulation of actin, a key structural protein involved in cell movement, growth, and repair. As a result, it has become a focal point of research into tissue regeneration, inflammation control, and recovery dynamics.
Understanding TB-500
TB-500 is a 43-amino-acid peptide involved in several essential cellular processes, including cell migration, differentiation, and proliferation. It is naturally abundant in tissues such as muscle, blood cells, and wound sites, where repair and regeneration are most active.
Researchers are particularly interested in TB-500’s ability to influence angiogenesis (the formation of new blood vessels), which supports oxygen and nutrient delivery to recovering tissues.
Mechanism of Action
The peptide’s mechanism of action is believed to centre on its interaction with actin, promoting cell movement and structural stability. TB-500 appears to encourage angiogenesis, cell regeneration, and tissue repair, while also demonstrating anti-inflammatory properties that may assist in reducing inflammation and supporting immune modulation.
Research Focus Areas
-
Accelerated Recovery – TB-500 has been widely studied for its potential role in supporting recovery from muscle or connective tissue injury. By promoting cellular repair and regeneration, it may help improve recovery rates in controlled research settings.
-
Performance and Endurance Studies – Research in sports science contexts has examined TB-500’s possible influence on strength, endurance, and fatigue resistance, with early findings suggesting a role in optimising muscle growth and recovery cycles.
-
Inflammation and Pain Modulation – TB-500’s potential anti-inflammatory and immune-modulating properties have made it a focus in studies relating to pain management and mobility restoration following chronic injuries.
-
Hair Growth Research – Preliminary studies suggest that TB-500 may have a role in promoting follicular activity and supporting hair growth, though further data is required to confirm this mechanism.
Scientific Context and Ongoing Research
While the peptide’s mechanisms are not yet fully characterised, TB-500 remains an active subject of academic and laboratory study in the fields of cellular biology, tissue engineering, and regenerative research. Its multi-faceted potential—spanning recovery, inflammation, and vascular health—makes it a promising candidate for continued investigation.
Technical Details
- Synonyms: Thymosin Beta-4, Tβ4, Beta-Thymosin 4, Timbetasin
- Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- IUPAC Condensed: Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser
- Molecular Weight: ~4,963 g/mol
- CAS Number: 77591-33-4
- PubChem CID: 16132341
- Further References: PubChem
Stability and Storage
Store lyophilised peptide at –20 °C.
Aliquot after reconstitution to avoid repeated freeze–thaw cycles.
Reconstituted peptide can be stored at 4 °C for short-term use.
When stored correctly at –20 °C, the lyophilised product remains stable until expiry.
Source and Reconstitution
Source: Biosynthesis
Reconstitution: Reconstitute with Bacteriostatic Water
Usage
Product is intended for LABORATORY RESEARCH ONLY.
TB-500 for sale at Pure Peptides UK is strictly limited to scientific and educational research purposes.
Only purchase TB-500 if you are a licensed researcher.
Images for illustration purposes only.
Conclusion
TB-500 2 mg represents a synthetic analogue of Thymosin Beta-4, designed for controlled research into cellular repair, angiogenesis, and recovery mechanisms.
Its multifaceted biological role continues to make it a key peptide in regenerative and performance research, offering exciting potential for the exploration of cellular health and tissue restoration.








